PPIRE12956
Target Protein Information
| Protein_Name | Proliferating cell nuclear antigen |
|---|---|
| Protein_Sequence | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
| Organism_Source | Homo sapiens |
| Functional_Classification | sliding clamp |
| Cellular_Localization | Nucleus |
| Gene_Names | PCNA |
| UniProt_ID | P12004 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p21 peptide |
|---|---|
| Peptide_Sequence | CRQTSMTDFYHSKRRLIFS |
| Peptide_Length | 19 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CS)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2376.74 |
|---|---|
| Aliphatic_Index | 41.05263 |
| Aromaticity | 0.15789 |
| Average_Rotatable_Bonds | 4.15789 |
| Charge_at_pH_7 | 3.02621 |
| Isoelectric_Point | 10.44876 |
|---|---|
| Hydrogen_Bond_Acceptors | 35 |
| Hydrogen_Bond_Donors | 40 |
| Topological_Polar_Surface_Area | 1029.29000 |
| X_logP_energy | -11.30319 |
Interaction Information
| Affinity | KD=342 nM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Developing peptide-based multivalent antagonists of proliferating cell nuclear antigen and a fluorescence-based PCNA binding assay. |
| Release_Year | 2012 |
| PMID | 22522186 |
| DOI | 10.1016/j.ab.2012.04.018 |