PPIRE12959
Target Protein Information
| Protein_Name | von Hippel-Lindau disease tumor suppressor |
|---|---|
| Protein_Sequence | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin ligases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | VHL |
| UniProt_ID | P40337 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HIF-1alpha CODD peptide 13a |
|---|---|
| Peptide_Sequence | DEALAXYIPMDDDFQLRSF |
| Peptide_Length | 19 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | X6=3R,4S-3-fluoro-4-hydroxyproline |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2203.41 |
|---|---|
| Aliphatic_Index | 72.10526 |
| Aromaticity | 0.15789 |
| Average_Rotatable_Bonds | 3.68421 |
| Charge_at_pH_7 | -3.99931 |
| Isoelectric_Point | 3.57491 |
|---|---|
| Hydrogen_Bond_Acceptors | 30 |
| Hydrogen_Bond_Donors | 30 |
| Topological_Polar_Surface_Area | 910.28000 |
| X_logP_energy | -7.08813 |
Interaction Information
| Affinity | KD=12 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 6GFX |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | 3-Fluoro-4-hydroxyprolines: Synthesis, Conformational Analysis, and Stereoselective Recognition by the VHL E3 Ubiquitin Ligase for Targeted Protein Degradation. |
| Release_Year | 2018 |
| PMID | 29949369 |
| DOI | 10.1021/jacs.8b05807 |