PPIRE12989
Target Protein Information
| Protein_Name | Proliferating cell nuclear antigen |
|---|---|
| Protein_Sequence | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
| Organism_Source | Homo sapiens |
| Functional_Classification | DNA sliding clamp |
| Cellular_Localization | Nucleus |
| Gene_Names | PCNA |
| UniProt_ID | P12004 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | DVC1PIP N326P2V mutant |
|---|---|
| Peptide_Sequence | KRRSNSHQVVLSNYFPRVS |
| Peptide_Length | 19 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCCN)C(C)C)C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2274.57 |
|---|---|
| Aliphatic_Index | 66.31579 |
| Aromaticity | 0.10526 |
| Average_Rotatable_Bonds | 3.89474 |
| Charge_at_pH_7 | 4.08774 |
| Isoelectric_Point | 12.22714 |
|---|---|
| Hydrogen_Bond_Acceptors | 33 |
| Hydrogen_Bond_Donors | 38 |
| Topological_Polar_Surface_Area | 1049.15000 |
| X_logP_energy | -13.29389 |
Interaction Information
| Affinity | KD=38.6 mM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 5IY4 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structure of human PCNA in complex with the PIP box of DVC1. |
| Release_Year | 2016 |
| PMID | 27084448 |
| DOI | 10.1016/j.bbrc.2016.04.053 |