PPIRE13140
Target Protein Information
| Protein_Name | 14-3-3 protein zeta/delta |
|---|---|
| Protein_Sequence | MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
| Organism_Source | Homo sapiens |
| Functional_Classification | adaptor proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | YWHAZ |
| UniProt_ID | P63104 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3_pSer10_AcK9_AcK14 |
|---|---|
| Peptide_Sequence | ARTKQTARKSTGGKAPRKQL |
| Peptide_Length | 20 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)N)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)O |
| Chemical_Modification | S10=phosphorylation; K9=acetyl; K14=acetyl |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2183.55 |
|---|---|
| Aliphatic_Index | 34.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.90000 |
| Charge_at_pH_7 | 6.99679 |
| Isoelectric_Point | 12.82564 |
|---|---|
| Hydrogen_Bond_Acceptors | 34 |
| Hydrogen_Bond_Donors | 39 |
| Topological_Polar_Surface_Area | 1064.31000 |
| X_logP_energy | -15.54419 |
Interaction Information
| Affinity | KD=91.7 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Molecular basis for the recognition of phosphorylated and phosphoacetylated histone h3 by 14-3-3. |
| Release_Year | 2005 |
| PMID | 16246723 |
| DOI | 10.1016/j.molcel.2005.08.032 |