PPIRE13177
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | TENLEAIDLHTSAGYPYSALGIKKRDILDPTTRDVSKMKFYMDKYGLDLPYSTYVKDELRSIDKIKKGKSRLIEASSLNDSVYLRMAFGHLYEAFHANPGTITGSAVGCNPDTFWSKLPILLPGSLFAFDYSGYDASLSPVWFRALELVLREIGYSEEAVSLIEGINHTHHVYRNKTYCVLGGMPSGCSGTSIFNSMINNIIIRALLIKTFKGIDLDELNMVAYGDDVLASYPFPID |
| Organism_Source | Human enterovirus 71 |
| Functional_Classification | RNA-dependent RNA polymerases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | None |
| UniProt_ID | F8SSY1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | VPg |
|---|---|
| Peptide_Sequence | GAYSXXPKXXLKXPALRXXT |
| Peptide_Length | 20 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](C)NC(=O)CN)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)NCC(=O)N[C@H](C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1801.04 |
|---|---|
| Aliphatic_Index | 49.00000 |
| Aromaticity | 0.05000 |
| Average_Rotatable_Bonds | 2.85000 |
| Charge_at_pH_7 | 2.99654 |
| Isoelectric_Point | 10.90181 |
|---|---|
| Hydrogen_Bond_Acceptors | 27 |
| Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 773.27000 |
| X_logP_energy | -11.35223 |
Interaction Information
| Affinity | KD=57.5 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4IKA |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structure of enterovirus 71 RNA-dependent RNA polymerase complexed with its protein primer VPg: implication for a trans mechanism of VPg uridylylation. |
| Release_Year | 2013 |
| PMID | 23487447 |
| DOI | 10.1128/JVI.02733-12 |