PPIRE13289
Target Protein Information
| Protein_Name | Protein C-ets-1 |
|---|---|
| Protein_Sequence | MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE |
| Organism_Source | Homo sapiens |
| Functional_Classification | ETS family |
| Cellular_Localization | Nucleus |
| Gene_Names | ETS1 |
| UniProt_ID | P14921 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Val2P* |
|---|---|
| Peptide_Sequence | RVPSPVDSPVDVEDVPAALW |
| Peptide_Length | 20 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@@H](N)CCCNC(=N)N)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | Ser282=phosphorylation; Ser285=phosphorylation |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2148.40 |
|---|---|
| Aliphatic_Index | 102.00000 |
| Aromaticity | 0.05000 |
| Average_Rotatable_Bonds | 2.95000 |
| Charge_at_pH_7 | -2.99890 |
| Isoelectric_Point | 3.69901 |
|---|---|
| Hydrogen_Bond_Acceptors | 28 |
| Hydrogen_Bond_Donors | 27 |
| Topological_Polar_Surface_Area | 848.41000 |
| X_logP_energy | -6.73903 |
Interaction Information
| Affinity | KD=250 uM |
|---|---|
| Affinity_Assay | NMR spectroscopy |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The Biophysical Basis for Phosphorylation-Enhanced DNA-Binding Autoinhibition of the ETS1 Transcription Factor. |
| Release_Year | 2019 |
| PMID | 30597162 |
| DOI | 10.1016/j.jmb.2018.12.011 |