PPIRE13309
Target Protein Information
| Protein_Name | Apoptosis regulator Bcl-2 |
|---|---|
| Protein_Sequence | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
| Organism_Source | Homo sapiens |
| Functional_Classification | Bcl-2 family |
| Cellular_Localization | Mitochondrion |
| Gene_Names | BCL2 |
| UniProt_ID | P10415 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Bax BH3 peptide |
|---|---|
| Peptide_Sequence | STKKLSECLKRIGDELDSNM |
| Peptide_Length | 20 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CO)[C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCSC)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2267.60 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.15000 |
| Charge_at_pH_7 | -0.06044 |
| Isoelectric_Point | 6.44900 |
|---|---|
| Hydrogen_Bond_Acceptors | 36 |
| Hydrogen_Bond_Donors | 37 |
| Topological_Polar_Surface_Area | 1029.39000 |
| X_logP_energy | -12.32943 |
Interaction Information
| Affinity | IC50=15 uM |
|---|---|
| Affinity_Assay | GST pull-down assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptides derived from BH3 domains of Bcl-2 family members: a comparative analysis of inhibition of Bcl-2, Bcl-x(L)and Bax oligomerization, induction of cytochrome c release, and activation of cell death. |
| Release_Year | 2002 |
| PMID | 12135371 |
| DOI | 10.1021/bi025605h |