PPIRE13347
Target Protein Information
| Protein_Name | Immunoglobulin heavy constant gamma 1 |
|---|---|
| Protein_Sequence | ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA |
| Organism_Source | Homo sapiens |
| Functional_Classification | immunoglobulin G1 |
| Cellular_Localization | Extracellular |
| Gene_Names | IGHG1 |
| UniProt_ID | P01857 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | E6-3K |
|---|---|
| Peptide_Sequence | FPCWALPSQYLCRPGSGKKK |
| Peptide_Length | 20 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CS)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)Cc1ccccc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C2<->C13; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2266.71 |
|---|---|
| Aliphatic_Index | 44.00000 |
| Aromaticity | 0.15000 |
| Average_Rotatable_Bonds | 3.45000 |
| Charge_at_pH_7 | 3.87230 |
| Isoelectric_Point | 10.14393 |
|---|---|
| Hydrogen_Bond_Acceptors | 31 |
| Hydrogen_Bond_Donors | 31 |
| Topological_Polar_Surface_Area | 849.38000 |
| X_logP_energy | -6.82203 |
Interaction Information
| Affinity | KD=110 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptides that bind specifically to an antibody from a chronic lymphocytic leukemia clone expressing unmutated immunoglobulin variable region genes. |
| Release_Year | 2013 |
| PMID | 23922242 |
| DOI | 10.2119/molmed.2013.00082 |