PPIRE13377
Target Protein Information
| Protein_Name | Calsenilin isoform 4 |
|---|---|
| Protein_Sequence | MRQLPAGPSSLACSGCKAGRLVTVPFSSRDAEDQGSREGIGWQPPGRSWAHTTEQEGKHQVAKATVHPPGPDALLLNQVDPVQCCPTRL |
| Organism_Source | Mus musculus |
| Functional_Classification | calcium-binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Kcnip3 |
| UniProt_ID | P0C092 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Kv4.3(2-22) |
|---|---|
| Peptide_Sequence | AAGVAAWLPFARAAAIGWMPV |
| Peptide_Length | 21 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](C)N)C(C)C)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCSC)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Fitc |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2126.55 |
|---|---|
| Aliphatic_Index | 102.85714 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 2.76190 |
| Charge_at_pH_7 | 0.99798 |
| Isoelectric_Point | 10.55000 |
|---|---|
| Hydrogen_Bond_Acceptors | 24 |
| Hydrogen_Bond_Donors | 25 |
| Topological_Polar_Surface_Area | 721.22000 |
| X_logP_energy | -2.36003 |
Interaction Information
| Affinity | KD=5 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Pb2+ Binds to Downstream Regulatory Element Antagonist Modulator (DREAM)and Modulates Its Interactions with Binding Partners: A Link between Neuronal Calcium Sensors and Pb2+ Neurotoxicity. |
| Release_Year | 2018 |
| PMID | 30399317 |
| DOI | 10.1021/acschemneuro.8b00335 |