PPIRE13419
Target Protein Information
| Protein_Name | Apoptosis regulator Bcl-2 |
|---|---|
| Protein_Sequence | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK |
| Organism_Source | Homo sapiens |
| Functional_Classification | BCL-2 family |
| Cellular_Localization | Mitochondrion |
| Gene_Names | BCL2 |
| UniProt_ID | P10415 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | BH3BIM(I155R/E158S) |
|---|---|
| Peptide_Sequence | EIWIAQELRRRGDSFNAYYAR |
| Peptide_Length | 21 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](NC(=O)[C@@H](N)CCC(=O)O)[C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2614.91 |
|---|---|
| Aliphatic_Index | 70.00000 |
| Aromaticity | 0.19048 |
| Average_Rotatable_Bonds | 4.04762 |
| Charge_at_pH_7 | 1.00027 |
| Isoelectric_Point | 9.16994 |
|---|---|
| Hydrogen_Bond_Acceptors | 34 |
| Hydrogen_Bond_Donors | 43 |
| Topological_Polar_Surface_Area | 1167.48000 |
| X_logP_energy | -9.82242 |
Interaction Information
| Affinity | KD=192 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Conversion of cell-survival activity of Akt into apoptotic death of cancer cells by two mutations on the BIM BH3 domain. |
| Release_Year | 2015 |
| PMID | 26136077 |
| DOI | 10.1038/cddis.2015.118 |