PPIRE13446
Target Protein Information
| Protein_Name | Mitogen-activated protein kinase 14 |
|---|---|
| Protein_Sequence | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
| Organism_Source | Homo sapiens |
| Functional_Classification | MAP kinase |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAPK14 |
| UniProt_ID | Q16539 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 1 |
|---|---|
| Peptide_Sequence | KRELVEPLTPSGEAPNQALLR |
| Peptide_Length | 21 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCCN)C(C)C)[C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2318.66 |
|---|---|
| Aliphatic_Index | 97.61905 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.57143 |
| Charge_at_pH_7 | 0.00301 |
| Isoelectric_Point | 6.61048 |
|---|---|
| Hydrogen_Bond_Acceptors | 32 |
| Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 1007.31000 |
| X_logP_energy | -10.11156 |
Interaction Information
| Affinity | Km=840 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Kinetic mechanism of the p38-alpha MAP kinase: phosphoryl transfer to synthetic peptides. |
| Release_Year | 2000 |
| PMID | 10684658 |
| DOI | 10.1021/bi9919495 |