PPIRE13552
Target Protein Information
| Protein_Name | Chromobox protein homolog 5 |
|---|---|
| Protein_Sequence | MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS |
| Organism_Source | Homo sapiens |
| Functional_Classification | chromodomain proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | CBX5 |
| UniProt_ID | P45973 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Histone H3(1-22)K9me3 peptide |
|---|---|
| Peptide_Sequence | ARTKQTARXSTGGKAPRKQLAY |
| Peptide_Length | 22 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)CNC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)N)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | X9=trimethyl-lysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2346.68 |
|---|---|
| Aliphatic_Index | 35.90909 |
| Aromaticity | 0.04545 |
| Average_Rotatable_Bonds | 3.63636 |
| Charge_at_pH_7 | 5.99624 |
| Isoelectric_Point | 12.26643 |
|---|---|
| Hydrogen_Bond_Acceptors | 36 |
| Hydrogen_Bond_Donors | 41 |
| Topological_Polar_Surface_Area | 1116.72000 |
| X_logP_energy | -16.10399 |
Interaction Information
| Affinity | KD=0.38 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Extended string-like binding of the phosphorylated HP1Alpha N-terminal tail to the lysine 9-methylated histone H3 tail. |
| Release_Year | 2016 |
| PMID | 26934956 |
| DOI | 10.1038/srep22527 |