PPIRE13601
Target Protein Information
| Protein_Name | Protein S100-B |
|---|---|
| Protein_Sequence | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | EF-hand calcium-binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | S100b |
| UniProt_ID | P04631 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p53F385W |
|---|---|
| Peptide_Sequence | SHLKSKKGQSTSRHKKLMWKTE |
| Peptide_Length | 22 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](N)CO)[C@@H](C)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2626.08 |
|---|---|
| Aliphatic_Index | 35.45455 |
| Aromaticity | 0.04545 |
| Average_Rotatable_Bonds | 4.36364 |
| Charge_at_pH_7 | 6.17980 |
| Isoelectric_Point | 11.45768 |
|---|---|
| Hydrogen_Bond_Acceptors | 41 |
| Hydrogen_Bond_Donors | 43 |
| Topological_Polar_Surface_Area | 1167.36000 |
| X_logP_energy | -13.39023 |
Interaction Information
| Affinity | KD=182.3 nM |
|---|---|
| Affinity_Assay | fluorescence spectroscopy |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Location of the Zn(2+)-binding site on S100B as determined by NMR spectroscopy and site-directed mutagenesis. |
| Release_Year | 2003 |
| PMID | 14621986 |
| DOI | 10.1021/bi035334q |