PPIRE13616
Target Protein Information
| Protein_Name | Pancreatic alpha-amylase |
|---|---|
| Protein_Sequence | MKLFLLLSAFGFCWAQYAPQTQSGRTSIVHLFEWRWVDIALECERYLGPKGFGGVQVSPPNENIVVTNPSRPWWERYQPVSYKLCTRSGNENEFRDMVTRCNNVGVRIYVDAVINHMCGSGAAAGTGTTCGSYCNPGNREFPAVPYSAWDFNDGKCKTASGGIESYNDPYQVRDCQLVGLLDLALEKDYVRSMIADYLNKLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTNWFPAGSRPFIFQEVIDLGGEAIQSSEYFGNGRVTEFKYGAKLGTVVRKWSGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKVAVGFMLAHPYGFTRVMSSYRWARNFVNGQDVNDWIGPPNNNGVIKEVTINADTTCGNDWVCEHRWRQIRNMVWFRNVVDGQPFANWWANGSNQVAFGRGNRGFIVFNNDDWQLSSTLQTGLPGGTYCDVISGDKVGNSCTGIKVYVSSDGTAQFSISNSAEDPFIAIHAESKL |
| Organism_Source | Sus scrofa |
| Functional_Classification | hydrolases |
| Cellular_Localization | Extracellular |
| Gene_Names | AMY2 |
| UniProt_ID | P00690 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CSP2 |
|---|---|
| Peptide_Sequence | RCMAFLLSDGAAAAQQLLPQYW |
| Peptide_Length | 22 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2453.86 |
|---|---|
| Aliphatic_Index | 93.63636 |
| Aromaticity | 0.13636 |
| Average_Rotatable_Bonds | 3.45455 |
| Charge_at_pH_7 | -0.06440 |
| Isoelectric_Point | 6.15812 |
|---|---|
| Hydrogen_Bond_Acceptors | 32 |
| Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 950.35000 |
| X_logP_energy | -6.87473 |
Interaction Information
| Affinity | IC50=0.04 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Extraction, identification, and structure-activity relationship of antioxidative and Alpha-amylase inhibitory peptides from cumin seeds (Cuminum cyminum) |
| Release_Year | 2016 |
| PMID | None |
| DOI | 10.1016/j.jff.2016.01.011 |