PPIRE13631
Target Protein Information
| Protein_Name | Regulatory protein cro |
|---|---|
| Protein_Sequence | MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSNKKTTA |
| Organism_Source | Escherichia phage lambda |
| Functional_Classification | helix-turn-helix |
| Cellular_Localization | Cytoplasm |
| Gene_Names | cro |
| UniProt_ID | P03040 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Cro:1 |
|---|---|
| Peptide_Sequence | GQTKTAKDLGVYQSAINKAIHAG |
| Peptide_Length | 23 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)CN)[C@@H](C)O)[C@@H](C)O)C(C)C)[C@@H](C)CC)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](C)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2371.68 |
|---|---|
| Aliphatic_Index | 80.86957 |
| Aromaticity | 0.04348 |
| Average_Rotatable_Bonds | 3.52174 |
| Charge_at_pH_7 | 2.08760 |
| Isoelectric_Point | 10.11974 |
|---|---|
| Hydrogen_Bond_Acceptors | 36 |
| Hydrogen_Bond_Donors | 36 |
| Topological_Polar_Surface_Area | 1057.75000 |
| X_logP_energy | -13.23190 |
Interaction Information
| Affinity | KD=25 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A synthetic peptide mimic of Lambda-Cro shows sequence-specific binding in vitro and in vivo. |
| Release_Year | 2012 |
| PMID | 22480451 |
| DOI | 10.1021/cb200523n |