PPIRE13769
Target Protein Information
| Protein_Name | Nuclear receptor subfamily 1 group I member 2 |
|---|---|
| Protein_Sequence | MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS |
| Organism_Source | Homo sapiens |
| Functional_Classification | nuclear receptors |
| Cellular_Localization | Nucleus |
| Gene_Names | NR1I2 |
| UniProt_ID | O75469 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NCoR(2251-2275) |
|---|---|
| Peptide_Sequence | GHSFADPASNLGLEDIIRKALMGSF |
| Peptide_Length | 25 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CN)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)O)[C@@H](C)CC |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2647.00 |
|---|---|
| Aliphatic_Index | 90.00000 |
| Aromaticity | 0.08000 |
| Average_Rotatable_Bonds | 3.48000 |
| Charge_at_pH_7 | -0.90874 |
| Isoelectric_Point | 5.51936 |
|---|---|
| Hydrogen_Bond_Acceptors | 37 |
| Hydrogen_Bond_Donors | 37 |
| Topological_Polar_Surface_Area | 1085.21000 |
| X_logP_energy | -11.01283 |
Interaction Information
| Affinity | KD=200 uM |
|---|---|
| Affinity_Assay | total internal reflection fluorescence microscopy |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Rifampicin-independent interactions between the pregnane X receptor ligand binding domain and peptide fragments of coactivator and corepressor proteins. |
| Release_Year | 2011 |
| PMID | 22185585 |
| DOI | 10.1021/bi2011674 |