PPIRE13844
Target Protein Information
| Protein_Name | Apoptosis regulator Bcl-2 homolog |
|---|---|
| Protein_Sequence | MEGEELIYHNIINEILVGYIKYYINDISEHELSPYQQQIKKILTYYDECLNKQVTITFSLTSVQEIKTQFTGVVTELFKDLINWGRICGFIVFSAKMAKYCKDANNHLESTVITTAYNFMKHNLLPWMISHGGQEEFLAFSLHSDMYSVIFNIKYFLSKFCNHMFFRSCVQLLRNCNLI |
| Organism_Source | African swine fever virus (strain Badajoz 1971 Vero-adapted) |
| Functional_Classification | Bcl-2 family proteins |
| Cellular_Localization | Mitochondrion |
| Gene_Names | None |
| UniProt_ID | P42485 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Beclin BH3 motif |
|---|---|
| Peptide_Sequence | DGGTMENLSRRLKVTGDLFDIMSGQT |
| Peptide_Length | 26 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC(=O)O)[C@@H](C)O)C(C)C)[C@@H](C)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2842.19 |
|---|---|
| Aliphatic_Index | 71.15385 |
| Aromaticity | 0.03846 |
| Average_Rotatable_Bonds | 3.80769 |
| Charge_at_pH_7 | -0.99920 |
| Isoelectric_Point | 4.49932 |
|---|---|
| Hydrogen_Bond_Acceptors | 43 |
| Hydrogen_Bond_Donors | 45 |
| Topological_Polar_Surface_Area | 1277.17000 |
| X_logP_energy | -16.15446 |
Interaction Information
| Affinity | KD=1.9 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 6TZC |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal Structure of African Swine Fever Virus A179L with the Autophagy Regulator Beclin. |
| Release_Year | 2019 |
| PMID | 31461953 |
| DOI | 10.3390/v11090789 |