PPIRE13920
Target Protein Information
| Protein_Name | Multidrug resistance operon repressor |
|---|---|
| Protein_Sequence | MNYPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDEQRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELFAPLTPVEQATLVHLLDQCLAAQPLEDI |
| Organism_Source | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Functional_Classification | MarR family repressors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | mexR |
| UniProt_ID | P52003 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ArmRC |
|---|---|
| Peptide_Sequence | ARRDYTEQLRRAARRNAWDLYGEHFY |
| Peptide_Length | 26 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)N)[C@@H](C)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3314.63 |
|---|---|
| Aliphatic_Index | 45.38462 |
| Aromaticity | 0.19231 |
| Average_Rotatable_Bonds | 4.11538 |
| Charge_at_pH_7 | 2.09077 |
| Isoelectric_Point | 9.82715 |
|---|---|
| Hydrogen_Bond_Acceptors | 44 |
| Hydrogen_Bond_Donors | 57 |
| Topological_Polar_Surface_Area | 1522.99000 |
| X_logP_energy | -14.12078 |
Interaction Information
| Affinity | KD=160 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 3ECH |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The crystal structure of MexR from Pseudomonas aeruginosa in complex with its antirepressor ArmR. |
| Release_Year | 2008 |
| PMID | 18812515 |
| DOI | 10.1073/pnas.0805489105 |