PPIRE14000
Target Protein Information
| Protein_Name | MOB kinase activator 1A |
|---|---|
| Protein_Sequence | MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR |
| Organism_Source | Homo sapiens |
| Functional_Classification | Hippo pathway scaffold |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MOB1A |
| UniProt_ID | Q9H8S9 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Mst2deltaL/MBM |
|---|---|
| Peptide_Sequence | DEEEEDXMKRNATSPQVQRPSFMDYFDK |
| Peptide_Length | 28 |
| Peptide_SMILES | CSCC[C@H](NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C)[C@@H](C)O |
| Chemical_Modification | X7=phosphothreonine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3350.59 |
|---|---|
| Aliphatic_Index | 13.92857 |
| Aromaticity | 0.10714 |
| Average_Rotatable_Bonds | 4.03571 |
| Charge_at_pH_7 | -3.99458 |
| Isoelectric_Point | 4.05701 |
|---|---|
| Hydrogen_Bond_Acceptors | 50 |
| Hydrogen_Bond_Donors | 50 |
| Topological_Polar_Surface_Area | 1515.87000 |
| X_logP_energy | -17.33816 |
Interaction Information
| Affinity | KD=230 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling. |
| Release_Year | 2015 |
| PMID | 26108669 |
| DOI | 10.1101/gad.264929.115 |