PPIRE14046
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MRPTCPPPARWFCLLTGALVCVLGPAGGWAVGLQQEECDYLRMIAVQHEQCLEEAQLENETAGCGKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTEAGWTPLEPGPYPVACGLDDNSSSLDEQQTMFYSSVKTGYTIGYSLSLATLLVATAILSLFRKLHCTRNYIHMHLFISFILRAAAVFIKDLALFNSGETDHCSKGSVGCKAAVVLFQYCVMANFFWLLVEGLYLHTLLAVSFFSERKYFWGYIFIGWGVPSTFTLVWTIIRIHFEDYGCWDTINSSLWWIIKAPILASILVNFILFIRIIGILVQKLRTPDVGKSDSSPYSRLAKSTLLLIPLFGVHYIMFAFFPDNFKAEVKLVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWDPKYQHPSAGSNGATCSTQVSMLTRVSPGAGRSSSFQAEVSLV |
| Organism_Source | Bos taurus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | VIPR1 |
| UniProt_ID | A2VDS6 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | VIP |
|---|---|
| Peptide_Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN |
| Peptide_Length | 28 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)Cc1c[nH]cn1)C(C)C)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3326.82 |
|---|---|
| Aliphatic_Index | 83.57143 |
| Aromaticity | 0.10714 |
| Average_Rotatable_Bonds | 4.03571 |
| Charge_at_pH_7 | 3.08719 |
| Isoelectric_Point | 10.32468 |
|---|---|
| Hydrogen_Bond_Acceptors | 48 |
| Hydrogen_Bond_Donors | 51 |
| Topological_Polar_Surface_Area | 1447.90000 |
| X_logP_energy | -14.61686 |
Interaction Information
| Affinity | KD=0.185 nM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthetic nitrovasodilators are effective, in vitro, in relaxing penile tissue from impotent men: the findings and their implications. |
| Release_Year | 1989 |
| PMID | 2496910 |
| DOI | 10.1139/y89-014 |