PPIRE14155
Target Protein Information
| Protein_Name | Translocator protein |
|---|---|
| Protein_Sequence | MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE |
| Organism_Source | Mus musculus |
| Functional_Classification | peripheral-type benzodiazepine receptor |
| Cellular_Localization | Mitochondrion |
| Gene_Names | Tspo |
| UniProt_ID | P50637 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Atrial natriuretic peptide(ANP) |
|---|---|
| Peptide_Sequence | SSLRSSCFGGRMDRIGAQSGLGCNSFRY |
| Peptide_Length | 28 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CS)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C7<->C23; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3013.37 |
|---|---|
| Aliphatic_Index | 45.35714 |
| Aromaticity | 0.10714 |
| Average_Rotatable_Bonds | 3.60714 |
| Charge_at_pH_7 | 2.87362 |
| Isoelectric_Point | 9.59233 |
|---|---|
| Hydrogen_Bond_Acceptors | 46 |
| Hydrogen_Bond_Donors | 53 |
| Topological_Polar_Surface_Area | 1361.71000 |
| X_logP_energy | -20.52802 |
Interaction Information
| Affinity | IC50=88 nM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Brain and atrial natriuretic peptides bind to common receptors in brain capillary endothelial cells. |
| Release_Year | 1987 |
| PMID | 1678581 |
| DOI | 10.1152/ajpendo.1991.261.2.e183 |