PPIRE14395
Target Protein Information
| Protein_Name | Low affinity immunoglobulin gamma Fc region receptor II |
|---|---|
| Protein_Sequence | MESNWTVHVFSRTLCHMLLWTAVLNLAAGTHDLPKAVVKLEPPWIQVLKEDTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIPKANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLPVLTIVAAVTGIAVAAIVIILVSLVYLKKKQVPALPGNPDHREMGETLPEEVGEYRQPSGGSVPVSPGPPSGLEPTSSSPYNPPDLEEAAKTEAENTITYSLLKHPEALDEETEHDYQNHI |
| Organism_Source | Mus musculus |
| Functional_Classification | Fc receptors |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Fcgr2 |
| UniProt_ID | P08101 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | OIP-1 c-peptide |
|---|---|
| Peptide_Sequence | NFSAADGGLRASVTLLGAGLLLSLLPALLRFGP |
| Peptide_Length | 33 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(=O)N1CCC[C@H]1C(=O)O)[C@@H](C)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3281.89 |
|---|---|
| Aliphatic_Index | 142.12121 |
| Aromaticity | 0.06061 |
| Average_Rotatable_Bonds | 3.15152 |
| Charge_at_pH_7 | 0.99842 |
| Isoelectric_Point | 10.39777 |
|---|---|
| Hydrogen_Bond_Acceptors | 42 |
| Hydrogen_Bond_Donors | 44 |
| Topological_Polar_Surface_Area | 1262.05000 |
| X_logP_energy | -10.98246 |
Interaction Information
| Affinity | KD=4.8 uM |
|---|---|
| Affinity_Assay | microtiter binding assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Osteoclast inhibitory peptide-1 binding to the Fc gammaRIIB inhibits osteoclast differentiation. |
| Release_Year | 2010 |
| PMID | 20610564 |
| DOI | 10.1210/en.2010-0244 |