PPIRE14479
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MNASHFLASLPPGSTPGENRSRLRDILFNFTNHCQDSVDPTALLITSYGLETVVGVLGNLCLLWVTLRQKDKTNVTNVLIANLAFSDFLMCLLCQPLTVVYTIMDYWIFGEALCKMSAFTQCTSVTVSILSLVLVALERHQLIVNPTGWRPSISQAYLGIVGIWVIATFLSLPFLAHSILDNVFQRNHSKALEFLADKLVCTESWPLDHHRMIYTTFLLLFQYCLPLVFILVCYVRIYRRLRRQGRAFRKGAHSMRGGRVKRVNVVLLAMVVAFAVLWLPLHVFNSLEDWYHEAIPVCHGNLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEVKALVLSCQQRAPREESERLPLSTVHTEVSKGSLRLSGRANPI |
| Organism_Source | Oryctolagus cuniculus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | npy4r |
| UniProt_ID | B6VRS6 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Rat pancreatic polypeptide |
|---|---|
| Peptide_Sequence | APLEPVYPGDNAAEQMAQYAAELRRYINMLTRPRY |
| Peptide_Length | 35 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)N)C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4069.63 |
|---|---|
| Aliphatic_Index | 70.00000 |
| Aromaticity | 0.11429 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | 0.00034 |
| Isoelectric_Point | 6.62364 |
|---|---|
| Hydrogen_Bond_Acceptors | 55 |
| Hydrogen_Bond_Donors | 57 |
| Topological_Polar_Surface_Area | 1687.87000 |
| X_logP_energy | -14.41832 |
Interaction Information
| Affinity | Ki=17.2 pM |
|---|---|
| Affinity_Assay | radioligand competition binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Blockade of pancreatic polypeptide-sensitive neuropeptide Y (NPY)receptors by agonist peptides is prevented by modulators of sodium transport. Implications for receptor signaling and regulation. |
| Release_Year | 2001 |
| PMID | 11390018 |
| DOI | 10.1016/s0196-9781(01)00414-4 |