PPIRE14517
Target Protein Information
| Protein_Name | 14-3-3 protein zeta/delta |
|---|---|
| Protein_Sequence | MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN |
| Organism_Source | Homo sapiens |
| Functional_Classification | adaptor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | YWHAZ |
| UniProt_ID | P63104 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | (cid:1)2-35pT |
|---|---|
| Peptide_Sequence | CRRFEKEKLKSQWNNDNPLFKSAXTTTVMNPKFAES |
| Peptide_Length | 36 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CS)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | X24=phosphothreonine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4203.76 |
|---|---|
| Aliphatic_Index | 35.27778 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.94444 |
| Charge_at_pH_7 | 2.94030 |
| Isoelectric_Point | 10.21524 |
|---|---|
| Hydrogen_Bond_Acceptors | 61 |
| Hydrogen_Bond_Donors | 63 |
| Topological_Polar_Surface_Area | 1819.96000 |
| X_logP_energy | -20.93986 |
Interaction Information
| Affinity | KD=261 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 2V7D |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Beta2 integrin phosphorylation on Thr758 acts as a molecular switch to regulate 14-3-3 and filamin binding. |
| Release_Year | 2008 |
| PMID | 18550856 |
| DOI | 10.1182/blood-2007-12-127795 |