PPIRE14558
Target Protein Information
| Protein_Name | Neuropeptide Y receptor type 2 |
|---|---|
| Protein_Sequence | MGPVGAKADENQTVEEMKVEKYHPRQTTPRVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVVCTEKWPGEEKNIYGTIYSLSSLLILYVFPLGIISFSYTRIWSKLKNHVSPGAASDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDNQVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLAAFRCEQRLDAIHSEVSVTFKSKKNLEVKKNHGPNDSFSEATNV |
| Organism_Source | Canis lupus familiaris |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | NPY2R |
| UniProt_ID | A0A8C0SG18 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PYY |
|---|---|
| Peptide_Sequence | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY |
| Peptide_Length | 36 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O)[C@@H](C)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4310.80 |
|---|---|
| Aliphatic_Index | 70.55556 |
| Aromaticity | 0.13889 |
| Average_Rotatable_Bonds | 3.72222 |
| Charge_at_pH_7 | 0.09188 |
| Isoelectric_Point | 7.51629 |
|---|---|
| Hydrogen_Bond_Acceptors | 59 |
| Hydrogen_Bond_Donors | 63 |
| Topological_Polar_Surface_Area | 1826.57000 |
| X_logP_energy | -15.82632 |
Interaction Information
| Affinity | KD=7.6 pM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA. |
| Release_Year | 1996 |
| PMID | None |
| DOI | 10.1152/ajpgi.1996.271.G36 |