PPIRE14596
Target Protein Information
| Protein_Name | Calcitonin gene-related peptide type 1 receptor |
|---|---|
| Protein_Sequence | MDKKHILCFLVLLPLNMALISAESEEGVNQTDLGVTRNKIMTAQYECYQKIMQDPIQQAEGLYCNRTWDGWLCWNDVAAGTESMQYCPDYFQDFDPSEKVTKICDQDGHWFRHPDSNRTWTNYTLCNNSTHEKVKTALNLFYLTIIGHGLSIASLIISLIIFFYFKSLSCQRITLHKNLFFSFICNSIVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGVYLHTLIVVAVFAEKQHLMWYYFLGWGFPLLPACIHAIARSLYYNDNCWISSDTHLLYIIHGPICAALLVNLFFLLNIVRVLITKLKVTHQVESNLYMKAVRATLILVPLLGIEFVLFPWRPEGKVAEEVYDYVMHILMHFQGLLVATIFCFFNGEVQAILRRNWNQYKIQFGNGFSHSDALRSASYTVSTISDMQGYSHDCPTEHLNGKSIQDIENVALKSENMYDLVM |
| Organism_Source | Mus musculus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Calcrl |
| UniProt_ID | Q9R1W5 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | human calcitonin gene-related peptide(CGRP) |
|---|---|
| Peptide_Sequence | AHSDGTFTSDYSKYLDSRRAQDFVQWLMNTLGKALSG |
| Peptide_Length | 37 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)N)[C@@H](C)O)[C@@H](C)O)C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)NCC(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C2<->C7; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4167.58 |
|---|---|
| Aliphatic_Index | 58.10811 |
| Aromaticity | 0.13514 |
| Average_Rotatable_Bonds | 3.70270 |
| Charge_at_pH_7 | 0.08838 |
| Isoelectric_Point | 7.53416 |
|---|---|
| Hydrogen_Bond_Acceptors | 61 |
| Hydrogen_Bond_Donors | 65 |
| Topological_Polar_Surface_Area | 1812.00000 |
| X_logP_energy | -21.33606 |
Interaction Information
| Affinity | KD=25 nM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and thermodynamic characterization of the interaction of the SH3 domain from Fyn with the proline-rich binding site on the p85 subunit of PI3-kinase. |
| Release_Year | 1994 |
| PMID | None |
| DOI | 10.1016/0169-6009(93)00650-R |