PPIRE14855
Target Protein Information
| Protein_Name | Large ribosomal subunit protein eL22 |
|---|---|
| Protein_Sequence | MAPVKKLVAKGGKKKKQVLKFTLDCTHPVEDGIMDAANFEQFLQERIKVNGKAGNLGGGVVTIERSKSKITVTSEEPFSKRYLKYLTKKYLKKNNLRDWLRVVANSKESYELRYFQINQDEEEEEDED |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | telomere-binding OB-fold protein |
| Cellular_Localization | Nucleus |
| Gene_Names | Rpl22 |
| UniProt_ID | P47198 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Pol1CBM |
|---|---|
| Peptide_Sequence | SPLKLQSRKLRYANDVQDLLDDVENSPVVATKRQNV |
| Peptide_Length | 36 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)O)C(C)C)[C@@H](C)O)C(C)C)C(C)C)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 4110.64 |
|---|---|
| Aliphatic_Index | 100.00000 |
| Aromaticity | 0.02778 |
| Average_Rotatable_Bonds | 3.88889 |
| Charge_at_pH_7 | 0.99980 |
| Isoelectric_Point | 9.21815 |
|---|---|
| Hydrogen_Bond_Acceptors | 59 |
| Hydrogen_Bond_Donors | 63 |
| Topological_Polar_Surface_Area | 1874.19000 |
| X_logP_energy | -21.40189 |
Interaction Information
| Affinity | KD=3.8 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 3OIQ |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural bases of dimerization of yeast telomere protein Cdc13 and its interaction with the catalytic subunit of DNA polymerase Alpha. |
| Release_Year | 2011 |
| PMID | 20877309 |
| DOI | 10.1038/cr.2010.138 |