PPIRE14955
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MKTVTGPLFLCFWLQLNCVSRGEQVEQRPPHLSVREGDSAVITCTYTDPNSYYFFWYKQEPGASLQLLMKVFSSTEINEGQGFTVLLNKKDKRLSLNLTAAHPGDSAAYFCAVS/XDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLVLMAMVKKKNS |
| Organism_Source | Mus musculus |
| Functional_Classification | T cell receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Trav3-3/Trbc2 |
| UniProt_ID | Q5R1C3/A0A075B5J4 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | QL9 |
|---|---|
| Peptide_Sequence | QLSPFPFDL |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1063.22 |
|---|---|
| Aliphatic_Index | 86.66667 |
| Aromaticity | 0.22222 |
| Average_Rotatable_Bonds | 3.22222 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Hydrogen_Bond_Acceptors | 13 |
| Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 379.16000 |
| X_logP_energy | -1.40080 |
Interaction Information
| Affinity | KD=3.9 mM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 2I1C |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Alphabeta T cell receptor interactions with syngeneic and allogeneic ligands: affinity measurements and crystallization. |
| Release_Year | 1997 |
| PMID | 9391114 |
| DOI | 10.1073/pnas.94.25.13838 |