PPIRE14956
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MKTVTGPLFLCFWLQLNCVSRGEQVEQRPPHLSVREGDSAVITCTYTDPNSYYFFWYKQEPGASLQLLMKVFSSTEINEGQGFTVLLNKKDKRLSLNLTAAHPGDSAAYFCAVS/XDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADCGITSASYHQGVLSATILYEILLGKATLYAVLVSGLVLMAMVKKKNS |
| Organism_Source | Mus musculus |
| Functional_Classification | T cell receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Trav3-3/Trbc2 |
| UniProt_ID | Q5R1C3/A0A075B5J4 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | dEV8 |
|---|---|
| Peptide_Sequence | EQYKFYSV |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1063.17 |
|---|---|
| Aliphatic_Index | 36.25000 |
| Aromaticity | 0.37500 |
| Average_Rotatable_Bonds | 4.12500 |
| Charge_at_pH_7 | -0.00224 |
| Isoelectric_Point | 6.39541 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 434.12000 |
| X_logP_energy | -2.16120 |
Interaction Information
| Affinity | KD=84.1 mM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 2LOL |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Alphabeta T cell receptor interactions with syngeneic and allogeneic ligands: affinity measurements and crystallization. |
| Release_Year | 1997 |
| PMID | 9391114 |
| DOI | 10.1073/pnas.94.25.13838 |