PPIRE15015
Target Protein Information
| Protein_Name | cAMP-dependent protein kinase catalytic subunit alpha |
|---|---|
| Protein_Sequence | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF |
| Organism_Source | Homo sapiens |
| Functional_Classification | kinases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PRKACA |
| UniProt_ID | P17612 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Leu-Arg-Arg-Ala-Ala-Leu-Gly |
|---|---|
| Peptide_Sequence | LRRAALG |
| Peptide_Length | 7 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CC(C)C)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 755.92 |
|---|---|
| Aliphatic_Index | 140.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.57143 |
| Charge_at_pH_7 | 1.99798 |
| Isoelectric_Point | 12.50011 |
|---|---|
| Hydrogen_Bond_Acceptors | 10 |
| Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 361.72000 |
| X_logP_energy | -3.40296 |
Interaction Information
| Affinity | Ki=376 uM |
|---|---|
| Affinity_Assay | phosphotransferase assay (anion-exchange chromatography) |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Differential responses of cyclic GMP-dependent and cyclic AMP-dependent protein kinases to synthetic peptide inhibitors. |
| Release_Year | 1983 |
| PMID | 6615418 |
| DOI | 10.1042/bj2130159 |