PPIRE15180
Target Protein Information
| Protein_Name | Oxytocin-neurophysin 1 |
|---|---|
| Protein_Sequence | MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHEDPACDPEAAFSQH |
| Organism_Source | Bos taurus |
| Functional_Classification | peptide binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | OXT |
| UniProt_ID | P01175 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Phe-PheNH2 |
|---|---|
| Peptide_Sequence | FF |
| Peptide_Length | 2 |
| Peptide_SMILES | N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 312.37 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 1.00000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Hydrogen_Bond_Acceptors | 3 |
| Hydrogen_Bond_Donors | 3 |
| Topological_Polar_Surface_Area | 92.42000 |
| X_logP_energy | 1.36850 |
Interaction Information
| Affinity | KD=51.28 uM |
|---|---|
| Affinity_Assay | fluorescence spectroscopy |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding and fluorescence studies of the relationship between neurophysin-peptide interaction and neurophysin self-association: an allosteric system exhibiting minimal cooperativity |
| Release_Year | 1991 |
| PMID | 1868072 |
| DOI | 10.1021/bi00246a017 |