PPIRE15184
Target Protein Information
| Protein_Name | Oxytocin-neurophysin 1 |
|---|---|
| Protein_Sequence | MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHEDPACDPEAAFSQH |
| Organism_Source | Bos taurus |
| Functional_Classification | peptide binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | OXT |
| UniProt_ID | P01175 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Gly-TyrNH2 |
|---|---|
| Peptide_Sequence | GY |
| Peptide_Length | 2 |
| Peptide_SMILES | NCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 238.24 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.50000 |
| Average_Rotatable_Bonds | 2.50000 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Hydrogen_Bond_Acceptors | 4 |
| Hydrogen_Bond_Donors | 4 |
| Topological_Polar_Surface_Area | 112.65000 |
| X_logP_energy | -0.53720 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding and fluorescence studies of the relationship between neurophysin-peptide interaction and neurophysin self-association: an allosteric system exhibiting minimal cooperativity |
| Release_Year | 1991 |
| PMID | 1868072 |
| DOI | 10.1021/bi00246a017 |