PPIRE15186
Target Protein Information
| Protein_Name | Oxytocin-neurophysin 1 |
|---|---|
| Protein_Sequence | MAGSSLACCLLGLLALTSACYIQNCPLGGKRAVLDLDVRTCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCHEDPACDPEAAFSQH |
| Organism_Source | Bos taurus |
| Functional_Classification | peptide binding proteins |
| Cellular_Localization | Extracellular |
| Gene_Names | OXT |
| UniProt_ID | P01175 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ala-Tyr-PheNH2 |
|---|---|
| Peptide_Sequence | AYF |
| Peptide_Length | 3 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 399.45 |
|---|---|
| Aliphatic_Index | 33.33333 |
| Aromaticity | 0.66667 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Hydrogen_Bond_Acceptors | 5 |
| Hydrogen_Bond_Donors | 5 |
| Topological_Polar_Surface_Area | 141.75000 |
| X_logP_energy | 0.57880 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Binding and fluorescence studies of the relationship between neurophysin-peptide interaction and neurophysin self-association: an allosteric system exhibiting minimal cooperativity |
| Release_Year | 1991 |
| PMID | 1868072 |
| DOI | 10.1021/bi00246a017 |