PPIRE15266
Target Protein Information
| Protein_Name | cAMP-dependent protein kinase catalytic subunit alpha |
|---|---|
| Protein_Sequence | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF |
| Organism_Source | Bos taurus |
| Functional_Classification | serine threonine protein kinase |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PRKACA |
| UniProt_ID | P00517 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | histone H2B(29-35) |
|---|---|
| Peptide_Sequence | RKRSRKE |
| Peptide_Length | 7 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 959.12 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 5.28571 |
| Charge_at_pH_7 | 3.99916 |
| Isoelectric_Point | 12.24366 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 21 |
| Topological_Polar_Surface_Area | 533.19000 |
| X_logP_energy | -6.78799 |
Interaction Information
| Affinity | KD=9.1 pM |
|---|---|
| Affinity_Assay | fluorescence anisotropy titration |
| PDB_ID | None |
| Type | Substrate |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthetic peptide analogues differentially alter the binding affinities of cyclic nucleotide dependent protein kinases for nucleotide substrates |
| Release_Year | 1988 |
| PMID | 2837278 |
| DOI | 10.1021/bi00406a027 |