PPIRE15402
Target Protein Information
| Protein_Name | Cysteine-rich secretory protein 2 |
|---|---|
| Protein_Sequence | MALLPVLFLVTVLLPSLPAEGKDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY |
| Organism_Source | Homo sapiens |
| Functional_Classification | CRISP superfamily |
| Cellular_Localization | Extracellular |
| Gene_Names | CRISP2 |
| UniProt_ID | P16562 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | tpx-1-#1 |
|---|---|
| Peptide_Sequence | QLQVQREIVNKHNELR |
| Peptide_Length | 16 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCC(N)=O)C(C)C)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)C(C)C |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2004.28 |
|---|---|
| Aliphatic_Index | 109.37500 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.50000 |
| Charge_at_pH_7 | 1.09214 |
| Isoelectric_Point | 9.69216 |
|---|---|
| Hydrogen_Bond_Acceptors | 28 |
| Hydrogen_Bond_Donors | 32 |
| Topological_Polar_Surface_Area | 968.37000 |
| X_logP_energy | -9.98116 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthesis and application of peptide immunogens related to the sperm tail protein tpx-1 a member of the CRISP superfamily of proteins |
| Release_Year | 2001 |
| PMID | 11168883 |
| DOI | 10.1034/j.1399-3011.2001.00779.x |