PPIRE15405
Target Protein Information
| Protein_Name | Dynein light chain 1 cytoplasmic |
|---|---|
| Protein_Sequence | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
| Organism_Source | Homo sapiens |
| Functional_Classification | dynein light chains |
| Cellular_Localization | Cytoplasm |
| Gene_Names | DYNLL1 |
| UniProt_ID | P63167 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | EBOV VP35 (676) peptide |
|---|---|
| Peptide_Sequence | KTRNSQTQTD |
| Peptide_Length | 10 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1178.22 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.10000 |
| Charge_at_pH_7 | 0.99813 |
| Isoelectric_Point | 9.69502 |
|---|---|
| Hydrogen_Bond_Acceptors | 21 |
| Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 660.63000 |
| X_logP_energy | -11.83043 |
Interaction Information
| Affinity | KD=3.91 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | 7D35 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structure of human LC8 bound to a peptide from Ebola virus VP35 |
| Release_Year | 2021 |
| PMID | 33630249 |
| DOI | 10.1007/s12275-021-0641-7 |