PPIRE15451
Target Protein Information
| Protein_Name | |
|---|---|
| Protein_Sequence | TTTAPSVYPLVPGCGDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPRIPKPSTPPGSSCPPGNILGGPSVFIFPPKPKDALMISLTPKVTCVVVDVSEDDPDVHVSWFVDNKEVHTAWTQPREAQYNSTFRVVSALPIQHQDWMRGKEFKCKVNNKALPAPIERTISKPKGRAQTPQVYTIPPPREQMSKKKVSLTCLVTNFFSEAISVEWERNGELEQDYKNTPPILDSDGTYFLYSKLTVDTDSWLQGEIFTCSVVHEALHNHHTQKNLSRSPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg3 |
| UniProt_ID | A0A4U9FKB1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | D2 |
|---|---|
| Peptide_Sequence | HIHGWKSPLSSLGGG |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)Cc1c[nH]cn1)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)NCC(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1532.72 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.06667 |
| Average_Rotatable_Bonds | 3.13333 |
| Charge_at_pH_7 | 1.17951 |
| Isoelectric_Point | 9.70398 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 621.79000 |
| X_logP_energy | -6.88290 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Development Characterization and Immunotherapeutic Use of Peptide Mimics of the Thomsen-Friedenreich Carbohydrate Antigen |
| Release_Year | 2009 |
| PMID | 19649208 |
| DOI | 10.1593/neo.09504 |