PPIRE15466
Target Protein Information
| Protein_Name | Nucleophosmin |
|---|---|
| Protein_Sequence | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDDEDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | nuclear import receptors |
| Cellular_Localization | Nucleus |
| Gene_Names | Npm1 |
| UniProt_ID | P13084 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | rNLS |
|---|---|
| Peptide_Sequence | CYPDEVKRKKKP |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1490.78 |
|---|---|
| Aliphatic_Index | 24.16667 |
| Aromaticity | 0.08333 |
| Average_Rotatable_Bonds | 4.16667 |
| Charge_at_pH_7 | 2.93620 |
| Isoelectric_Point | 10.04100 |
|---|---|
| Hydrogen_Bond_Acceptors | 22 |
| Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 626.65000 |
| X_logP_energy | -4.60363 |
Interaction Information
| Affinity | KD=1.248 uM |
|---|---|
| Affinity_Assay | equilibrium dialysis |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Interaction of Nucleolar Protein B23 with Peptides Related to Nuclear Localization Signals |
| Release_Year | 1995 |
| PMID | None |
| DOI | 10.1021/bi9502710 |