PPIRE15523
Target Protein Information
| Protein_Name | Baculoviral IAP repeat-containing protein 7 |
|---|---|
| Protein_Sequence | MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | inhibitor of apoptosis proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | BIRC7 |
| UniProt_ID | Q96CA5 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | peptide 5 |
|---|---|
| Peptide_Sequence | ATAVIEKSE |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](C)N)[C@@H](C)O)C(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 947.05 |
|---|---|
| Aliphatic_Index | 97.77778 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.55556 |
| Charge_at_pH_7 | -0.99876 |
| Isoelectric_Point | 4.25815 |
|---|---|
| Hydrogen_Bond_Acceptors | 15 |
| Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 437.20000 |
| X_logP_energy | -4.74970 |
Interaction Information
| Affinity | IC50=317.9 uM |
|---|---|
| Affinity_Assay | DELFIA |
| PDB_ID | None |
| Type | Antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Evaluation of Assay Technologies for the Identification of Proteineptide Interaction Antagonists |
| Release_Year | 2007 |
| PMID | 17767418 |
| DOI | 10.1089/adt.2007.070 |