PPIRE15633
Target Protein Information
| Protein_Name | Ribonuclease pancreatic |
|---|---|
| Protein_Sequence | MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV |
| Organism_Source | Bos taurus |
| Functional_Classification | ribonucleases |
| Cellular_Localization | Extracellular |
| Gene_Names | RNASE1 |
| UniProt_ID | P61823 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | S2 |
|---|---|
| Peptide_Sequence | KETAAAKFERQHMDSSGC |
| Peptide_Length | 18 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1996.20 |
|---|---|
| Aliphatic_Index | 16.66667 |
| Aromaticity | 0.05556 |
| Average_Rotatable_Bonds | 3.83333 |
| Charge_at_pH_7 | 0.03032 |
| Isoelectric_Point | 7.36042 |
|---|---|
| Hydrogen_Bond_Acceptors | 32 |
| Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 916.32000 |
| X_logP_energy | -12.42113 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Real-Time Surface Plasmon Resonance Imaging Measurements for the Multiplexed Determination of Protein Adsorption/Desorption Kinetics and Surface Enzymatic Reactions on Peptide Microarrays |
| Release_Year | 2004 |
| PMID | 15456285 |
| DOI | 10.1021/ac0494275 |