PPIRE15656
Target Protein Information
| Protein_Name | Putative histone H1.9 |
|---|---|
| Protein_Sequence | MLHASTIWHLRSTPPRRKQWGHCDPHRILVASEVTTEITSPTPAPRAQVCGGQPWVTVLDPLSGHTGREAERHFATVSISAVELKYCHGWRPAGQRVPSKTATGQRTCAKPCQKPSTSKVILRAVADKGTCKYVSLATLKKAVSTTGYDMARNAYHFKRVLKGLVDKGSAGSFTLGKKQASKSKLKVKRQRQQRWRSGQRPFGQHRSLLGSKQGHKRLIKGVRRVAKCHCN |
| Organism_Source | Homo sapiens |
| Functional_Classification | histones |
| Cellular_Localization | Nucleus |
| Gene_Names | H1-9P |
| UniProt_ID | P60008 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | histone H1-binding peptide |
|---|---|
| Peptide_Sequence | CQRPPR |
| Peptide_Length | 6 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CS)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 755.89 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | 1.93600 |
| Isoelectric_Point | 10.52641 |
|---|---|
| Hydrogen_Bond_Acceptors | 11 |
| Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 358.13000 |
| X_logP_energy | -4.44346 |
Interaction Information
| Affinity | KD=803 mM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Conversion of Low-Affinity Peptides to High-Affinity Peptide Binders by Using a b-Hairpin Scaffold-Assisted Approach |
| Release_Year | 2014 |
| PMID | 25371172 |
| DOI | 10.1002/cbic.201402450 |