PPIRE15658
Target Protein Information
| Protein_Name | Putative histone H1.9 |
|---|---|
| Protein_Sequence | MLHASTIWHLRSTPPRRKQWGHCDPHRILVASEVTTEITSPTPAPRAQVCGGQPWVTVLDPLSGHTGREAERHFATVSISAVELKYCHGWRPAGQRVPSKTATGQRTCAKPCQKPSTSKVILRAVADKGTCKYVSLATLKKAVSTTGYDMARNAYHFKRVLKGLVDKGSAGSFTLGKKQASKSKLKVKRQRQQRWRSGQRPFGQHRSLLGSKQGHKRLIKGVRRVAKCHCN |
| Organism_Source | Homo sapiens |
| Functional_Classification | histones |
| Cellular_Localization | Nucleus |
| Gene_Names | H1-9P |
| UniProt_ID | P60008 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | G4 linker-assisted heterodimer peptide |
|---|---|
| Peptide_Sequence | CQRPPRGGGGHSPQAY |
| Peptide_Length | 16 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CNC(=O)CNC(=O)CNC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CS)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1667.82 |
|---|---|
| Aliphatic_Index | 6.25000 |
| Aromaticity | 0.06250 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | 2.02606 |
| Isoelectric_Point | 9.50122 |
|---|---|
| Hydrogen_Bond_Acceptors | 25 |
| Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 752.57000 |
| X_logP_energy | -11.37186 |
Interaction Information
| Affinity | KD=16 mM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Conversion of Low-Affinity Peptides to High-Affinity Peptide Binders by Using a b-Hairpin Scaffold-Assisted Approach |
| Release_Year | 2014 |
| PMID | 25371172 |
| DOI | 10.1002/cbic.201402450 |