PPIRE15691
Target Protein Information
| Protein_Name | Ig gamma-1 chain C region secreted form/Immunoglobulin kappa constant |
|---|---|
| Protein_Sequence | AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK/RADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC |
| Organism_Source | Mus musculus/Mus musculus |
| Functional_Classification | monoclonal antibody |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg1/Igkc |
| UniProt_ID | P01868/P01837 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CNLHNVIC |
|---|---|
| Peptide_Sequence | CNLHNVIC |
| Peptide_Length | 8 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CS)C(C)C)C(=O)N[C@@H](CS)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | side chain-side chain cyclization; C1<-->C8; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 915.09 |
|---|---|
| Aliphatic_Index | 133.75000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | -0.03506 |
| Isoelectric_Point | 7.25316 |
|---|---|
| Hydrogen_Bond_Acceptors | 14 |
| Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 381.88000 |
| X_logP_energy | -3.88370 |
Interaction Information
| Affinity | IC50=300 nM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A high-capacity alkaline phosphatase reporter system for the rapid analysis of specificity and relative affinity of peptides from phage-display libraries |
| Release_Year | 2001 |
| PMID | 11384683 |
| DOI | 10.1016/S0022-1759(01)00390-8 |