PPIRE15762
Target Protein Information
| Protein_Name | Papain |
|---|---|
| Protein_Sequence | MAMIPSISKLLFVAICLFVYMGLSFGDFSIVGYSQNDLTSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKKNNSYWLGLNVFADMSNDEFKEKYTGSIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRSYGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN |
| Organism_Source | Carica papaya |
| Functional_Classification | cysteine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P00784 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Thc-Fca-Gly-Gly-Arg(Mtr)-Tyr-OH (9) |
|---|---|
| Peptide_Sequence | XGGRY |
| Peptide_Length | 5 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)CNC(=O)CNC(=O)CN)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | X1=1'-aminoferrocene-1-carboxylic acid; R4=4-methyltrityl |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | thiostic acid |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 508.53 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | 0.99713 |
| Isoelectric_Point | 9.34881 |
|---|---|
| Hydrogen_Bond_Acceptors | 8 |
| Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 261.85000 |
| X_logP_energy | -3.55673 |
Interaction Information
| Affinity | Ki=210 mM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A Bioorganometallic Approach for the Electrochemical Detection of Proteins: A Study on the Interaction of Ferroceneeptide Conjugates with Papain in Solution and on Au Surfaces |
| Release_Year | 2007 |
| PMID | 17455185 |
| DOI | 10.1002/chem.200601878 |