PPIRE15790
Target Protein Information
| Protein_Name | IgG receptor FcRn large subunit p51 |
|---|---|
| Protein_Sequence | MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA |
| Organism_Source | Homo sapiens |
| Functional_Classification | Fc receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | FCGRT |
| UniProt_ID | P55899 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SYN723 |
|---|---|
| Peptide_Sequence | GGGCVTGHFGGIYCNYQ |
| Peptide_Length | 17 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)CNC(=O)CNC(=O)CN)C(C)C)[C@@H](C)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCC(N)=O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chainide chain cyclization; C4<-->C16; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1732.91 |
|---|---|
| Aliphatic_Index | 40.00000 |
| Aromaticity | 0.17647 |
| Average_Rotatable_Bonds | 3.05882 |
| Charge_at_pH_7 | -0.03676 |
| Isoelectric_Point | 7.24864 |
|---|---|
| Hydrogen_Bond_Acceptors | 26 |
| Hydrogen_Bond_Donors | 26 |
| Topological_Polar_Surface_Area | 704.47000 |
| X_logP_energy | -8.86800 |
Interaction Information
| Affinity | IC50=33 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structurectivity relationships of a peptide inhibitor of the human FcRn:human IgG interaction |
| Release_Year | 2008 |
| PMID | 18501614 |
| DOI | 10.1016/j.bmc.2008.05.004 |