PPIRE15863
Target Protein Information
| Protein_Name | Periplasmic serine endoprotease DegP |
|---|---|
| Protein_Sequence | MKKTTLALSALALSLGLALSPLSATAAETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ |
| Organism_Source | Escherichia coli O157:H7 |
| Functional_Classification | serine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | degP |
| UniProt_ID | P0C0V1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SsrA peptide |
|---|---|
| Peptide_Sequence | AANDENYALAA |
| Peptide_Length | 11 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](C)N)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | biotinylated |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1122.16 |
|---|---|
| Aliphatic_Index | 80.90909 |
| Aromaticity | 0.09091 |
| Average_Rotatable_Bonds | 3.09091 |
| Charge_at_pH_7 | -2.00064 |
| Isoelectric_Point | 3.55007 |
|---|---|
| Hydrogen_Bond_Acceptors | 17 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 535.33000 |
| X_logP_energy | -6.56950 |
Interaction Information
| Affinity | KD=4.9 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Substrate |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | PDZ Domains Facilitate Binding of High Temperature Requirement Protease A (HtrA) and Tail-specific Protease (Tsp) to Heterologous Substrates through Recognition of the Small Stable RNA A (ssrA)-encoded Peptide |
| Release_Year | 2002 |
| PMID | 12177052 |
| DOI | 10.1074/jbc.M202790200 |