PPIRE16274
Target Protein Information
| Protein_Name | Mitogen-activated protein kinase 14 |
|---|---|
| Protein_Sequence | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
| Organism_Source | Homo sapiens |
| Functional_Classification | protein serine threonine kinases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAPK14 |
| UniProt_ID | Q16539 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | JIP1 |
|---|---|
| Peptide_Sequence | PKRPTTLNLF |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | fluorescein rhodamine |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1186.42 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 3.60000 |
| Charge_at_pH_7 | 1.99769 |
| Isoelectric_Point | 11.65178 |
|---|---|
| Hydrogen_Bond_Acceptors | 16 |
| Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 473.91000 |
| X_logP_energy | -3.94343 |
Interaction Information
| Affinity | KD=3.7 mM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Selective targeting of MAPK family kinases JNK over p38 by rationally designed peptides as potential therapeutics for neurological disorders and epilepsy |
| Release_Year | 2016 |
| PMID | 27263470 |
| DOI | 10.1039/c6mb00297h |