PPIRE16286
Target Protein Information
| Protein_Name | Troponin C slow skeletal and cardiac muscles |
|---|---|
| Protein_Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE |
| Organism_Source | Oryctolagus cuniculus |
| Functional_Classification | EF hand calcium binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TNNC1 |
| UniProt_ID | P02591 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | TnI9639 |
|---|---|
| Peptide_Sequence | NQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVAMDLRAN |
| Peptide_Length | 44 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(N)=O)C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 5079.13 |
|---|---|
| Aliphatic_Index | 86.59091 |
| Aromaticity | 0.04545 |
| Average_Rotatable_Bonds | 4.06818 |
| Charge_at_pH_7 | 9.08844 |
| Isoelectric_Point | 12.26267 |
|---|---|
| Hydrogen_Bond_Acceptors | 69 |
| Hydrogen_Bond_Donors | 76 |
| Topological_Polar_Surface_Area | 2134.87000 |
| X_logP_energy | -19.25678 |
Interaction Information
| Affinity | KD=0.9 uM |
|---|---|
| Affinity_Assay | fluorescence spectroscopy |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Kinetic Analysis of the Interactions between Troponin C and the C-terminal Troponin I Regulatory Region and Validation of a New Peptide Delivery/Capture System used for Surface Plasmon Resonance |
| Release_Year | 2002 |
| PMID | 12381325 |
| DOI | 10.1016/S0022-2836(02)00883-5 |