PPIRE16346
Target Protein Information
| Protein_Name | Protein Tat |
|---|---|
| Protein_Sequence | MEPVDPRLEPWNHPGSQPKTACNNCYCKRCCYHCLYCFTKKGLGISYGRKKRSQRRRTPQSSKSHQDLIPEQPLSQQQGDQTGQKKQKEALESKTEADPCD |
| Organism_Source | Human immunodeficiency virus type 1 group N (isolate YBF30) |
| Functional_Classification | Viral transcriptional activators |
| Cellular_Localization | Nucleus |
| Gene_Names | tat |
| UniProt_ID | O91083 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p53(32655) |
|---|---|
| Peptide_Sequence | EYFTLQIRGRERFEMFRELNEALELKDAQA |
| Peptide_Length | 30 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CCC(=O)O)[C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3704.17 |
|---|---|
| Aliphatic_Index | 75.00000 |
| Aromaticity | 0.13333 |
| Average_Rotatable_Bonds | 4.30000 |
| Charge_at_pH_7 | -1.99208 |
| Isoelectric_Point | 4.50617 |
|---|---|
| Hydrogen_Bond_Acceptors | 49 |
| Hydrogen_Bond_Donors | 56 |
| Topological_Polar_Surface_Area | 1611.67000 |
| X_logP_energy | -12.55862 |
Interaction Information
| Affinity | KD=31 uM |
|---|---|
| Affinity_Assay | fluorescence anisotropy |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Using Peptides to Study the Interaction between the p53 Tetramerization Domain and HIV-1 Tat |
| Release_Year | 2008 |
| PMID | 18189286 |
| DOI | 10.1002/bip.20919 |