PPIRE16417
Target Protein Information
| Protein_Name | Phosphocarrier protein HPr |
|---|---|
| Protein_Sequence | MAERRVNVGWAEGLHARPASIFVRAATATGVPVTIAKADGSPVNAASMLAVLGLGAQGGEEIVLASDAEGAEAALERLAKLVAEGLEELPETV |
| Organism_Source | Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) |
| Functional_Classification | histidine phosphocarrier |
| Cellular_Localization | Cytoplasm |
| Gene_Names | ptsH |
| UniProt_ID | O50515 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | EINbsite |
|---|---|
| Peptide_Sequence | FVTEEGGPTSHSAILARA |
| Peptide_Length | 18 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccccc1)C(C)C)[C@@H](C)O)[C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1843.03 |
|---|---|
| Aliphatic_Index | 76.11111 |
| Aromaticity | 0.05556 |
| Average_Rotatable_Bonds | 3.16667 |
| Charge_at_pH_7 | -0.90756 |
| Isoelectric_Point | 5.49309 |
|---|---|
| Hydrogen_Bond_Acceptors | 27 |
| Hydrogen_Bond_Donors | 28 |
| Topological_Polar_Surface_Area | 795.33000 |
| X_logP_energy | -9.83563 |
Interaction Information
| Affinity | KD=18 uM |
|---|---|
| Affinity_Assay | Isothermal Titration Calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptides as Inhibitors of the First Phosphorylation Step of the Streptomyces coelicolor Phosphoenolpyruvate: Sugar Phosphotransferase System |
| Release_Year | 2012 |
| PMID | 22909257 |
| DOI | 10.1021/bi3010494 |